SCOPe 2.07: Domain d1u2wb_: 1u2w B:

Lineage for d1u2wb_ (1u2w B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Cadmium efflux system accessory protein CadC [140239] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [140240] (1 PDB entry)
   Uniprot P20047 12-119

8. Domain d1u2wb_: 1u2w B: [119488]
   automated match to d1u2wa1
   complexed with zn

Details for d1u2wb_

PDB Entry: 1u2w, 1.9 Å

PDB Description: crystal structure of the staphylococcus aureus pi258 cadc

PDB Compounds: (B:) Cadmium efflux system accessory protein

SCOPe Domain Sequences for d1u2wb_:

Sequence; same for both SEQRES and ATOM records:

>d1u2wb_ a.4.5.5 (B:) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]}
gydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvti
anashhlrtlykqgvvnfrkegklalyslgdehirqimmialahkke

Timeline for d1u2wb_:

• d1u2wb_ first appeared in SCOP 1.73, called d1u2wb1
  
• d1u2wb_ appears in SCOPe 2.06
  
• d1u2wb_ appears in the current release, SCOPe 2.08