SCOPe 2.05: Domain d1u2sa_: 1u2s A:

Lineage for d1u2sa_ (1u2s A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Sucrose-phosphatase Slr0953 [142163] (1 species)

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [142164] (9 PDB entries)
   Uniprot P74325 1-244

8. Domain d1u2sa_: 1u2s A: [119485]
   automated match to d1s2oa1
   complexed with glc, mg

Details for d1u2sa_

PDB Entry: 1u2s, 2.5 Å

PDB Description: x-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 in complex with glucose

PDB Compounds: (A:) Sucrose-Phosphatase

SCOPe Domain Sequences for d1u2sa_:

Sequence; same for both SEQRES and ATOM records:

>d1u2sa_ c.108.1.10 (A:) Sucrose-phosphatase Slr0953 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
dfls

Timeline for d1u2sa_:

• d1u2sa_ first appeared in SCOP 1.73, called d1u2sa1
  
• d1u2sa_ appears in SCOPe 2.04
  
• d1u2sa_ appears in SCOPe 2.06
  
• d1u2sa_ appears in the current release, SCOPe 2.08