Lineage for d1u2gc_ (1u2g C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862854Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
    automatically mapped to Pfam PF02233
  6. 2862855Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 2862865Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries)
  8. 2862869Domain d1u2gc_: 1u2g C: [119484]
    Other proteins in same PDB: d1u2ga1, d1u2ga2, d1u2gb1, d1u2gb2
    automated match to d1nm5c_
    complexed with apr, gol, ndp

Details for d1u2gc_

PDB Entry: 1u2g (more details), 2.2 Å

PDB Description: transhydrogenase (dI.ADPr)2(dIII.NADPH)1 asymmetric complex
PDB Compounds: (C:) NAD(P) transhydrogenase subunit beta

SCOPe Domain Sequences for d1u2gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2gc_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

SCOPe Domain Coordinates for d1u2gc_:

Click to download the PDB-style file with coordinates for d1u2gc_.
(The format of our PDB-style files is described here.)

Timeline for d1u2gc_: