![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
![]() | Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins) |
![]() | Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species) L-alanine dehydrogenase homologue |
![]() | Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries) |
![]() | Domain d1u2gb2: 1u2g B:1-143,B:327-381 [119483] Other proteins in same PDB: d1u2ga1, d1u2gb1, d1u2gc_ automated match to d1l7db2 complexed with apr, gol, ndp |
PDB Entry: 1u2g (more details), 2.2 Å
SCOPe Domain Sequences for d1u2gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2gb2 c.23.12.2 (B:1-143,B:327-381) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet vsgtcvtrdgaivhpaltg
Timeline for d1u2gb2: