SCOPe 2.07: Domain d1u2da2: 1u2d A:1-143,A:327-378

Lineage for d1u2da2 (1u2d A:1-143,A:327-378)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)

8. Domain d1u2da2: 1u2d A:1-143,A:327-378 [119476]
   Other proteins in same PDB: d1u2da1, d1u2db1, d1u2dc_
   automatically matched to d1f8ga2
   complexed with gol, nad, ndp

Details for d1u2da2

PDB Entry: 1u2d, 3 Å

PDB Description: Structre of transhydrogenaes (dI.NADH)2(dIII.NADPH)1 asymmetric complex

PDB Compounds: (A:) NAD(P) transhydrogenase subunit alpha part 1

SCOPe Domain Sequences for d1u2da2:

Sequence; same for both SEQRES and ATOM records:

>d1u2da2 c.23.12.2 (A:1-143,A:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpa

Timeline for d1u2da2:

• d1u2da2 first appeared in SCOP 1.73
  
• d1u2da2 appears in SCOPe 2.06
  
• d1u2da2 appears in the current release, SCOPe 2.08