![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein Cytohesin 2 [141401] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [141402] (2 PDB entries) Uniprot P63034 260-378 |
![]() | Domain d1u29a_: 1u29 A: [119473] automated match to d1fhxb_ complexed with i3p |
PDB Entry: 1u29 (more details), 1.8 Å
SCOPe Domain Sequences for d1u29a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u29a_ b.55.1.1 (A:) Cytohesin 2 {Mouse (Mus musculus) [TaxId: 10090]} pdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevddprk pncfelyipnnkgqlikackteadgrvvegnhmvyrisaptqeekdewiksiqaavsvd
Timeline for d1u29a_: