Lineage for d1u29a1 (1u29 A:260-378)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 672999Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
    Pfam PF00169
  6. 673033Protein Cytohesin 2 [141401] (1 species)
  7. 673034Species Mouse (Mus musculus) [TaxId:10090] [141402] (2 PDB entries)
  8. 673035Domain d1u29a1: 1u29 A:260-378 [119473]
    automatically matched to 1U27 A:260-378
    complexed with i3p

Details for d1u29a1

PDB Entry: 1u29 (more details), 1.8 Å

PDB Description: Triglycine variant of the ARNO Pleckstrin Homology Domain in complex with Ins(1,4,5)P3
PDB Compounds: (A:) Cytohesin 2

SCOP Domain Sequences for d1u29a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u29a1 b.55.1.1 (A:260-378) Cytohesin 2 {Mouse (Mus musculus) [TaxId: 10090]}
pdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevddprk
pncfelyipnnkgqlikackteadgrvvegnhmvyrisaptqeekdewiksiqaavsvd

SCOP Domain Coordinates for d1u29a1:

Click to download the PDB-style file with coordinates for d1u29a1.
(The format of our PDB-style files is described here.)

Timeline for d1u29a1: