Lineage for d1u29a_ (1u29 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394382Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2394416Protein Cytohesin 2 [141401] (1 species)
  7. 2394417Species Mouse (Mus musculus) [TaxId:10090] [141402] (2 PDB entries)
    Uniprot P63034 260-378
  8. 2394418Domain d1u29a_: 1u29 A: [119473]
    automated match to d1fhxb_
    complexed with i3p

Details for d1u29a_

PDB Entry: 1u29 (more details), 1.8 Å

PDB Description: Triglycine variant of the ARNO Pleckstrin Homology Domain in complex with Ins(1,4,5)P3
PDB Compounds: (A:) Cytohesin 2

SCOPe Domain Sequences for d1u29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u29a_ b.55.1.1 (A:) Cytohesin 2 {Mouse (Mus musculus) [TaxId: 10090]}
pdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevddprk
pncfelyipnnkgqlikackteadgrvvegnhmvyrisaptqeekdewiksiqaavsvd

SCOPe Domain Coordinates for d1u29a_:

Click to download the PDB-style file with coordinates for d1u29a_.
(The format of our PDB-style files is described here.)

Timeline for d1u29a_: