Lineage for d1u28c_ (1u28 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2471108Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
    automatically mapped to Pfam PF02233
  6. 2471109Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 2471119Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries)
  8. 2471126Domain d1u28c_: 1u28 C: [119472]
    Other proteins in same PDB: d1u28a1, d1u28a2, d1u28b1, d1u28b2
    automated match to d1nm5c_
    complexed with gol, nad, nap

Details for d1u28c_

PDB Entry: 1u28 (more details), 2.3 Å

PDB Description: r. rubrum transhydrogenase asymmetric complex (di.nad+)2(diii.nadp+)1
PDB Compounds: (C:) NAD(P) transhydrogenase subunit beta

SCOPe Domain Sequences for d1u28c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u28c_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

SCOPe Domain Coordinates for d1u28c_:

Click to download the PDB-style file with coordinates for d1u28c_.
(The format of our PDB-style files is described here.)

Timeline for d1u28c_: