Lineage for d1u28b2 (1u28 B:1-143,B:327-378)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826403Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 826462Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 826468Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
    L-alanine dehydrogenase homologue
  7. 826469Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)
  8. 826489Domain d1u28b2: 1u28 B:1-143,B:327-378 [119471]
    Other proteins in same PDB: d1u28a1, d1u28b1, d1u28c1
    automatically matched to d1f8ga2
    complexed with gol, nad, nap

Details for d1u28b2

PDB Entry: 1u28 (more details), 2.3 Å

PDB Description: r. rubrum transhydrogenase asymmetric complex (di.nad+)2(diii.nadp+)1
PDB Compounds: (B:) NAD(P) transhydrogenase subunit alpha part 1

SCOP Domain Sequences for d1u28b2:

Sequence, based on SEQRES records: (download)

>d1u28b2 c.23.12.2 (B:1-143,B:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpa

Sequence, based on observed residues (ATOM records): (download)

>d1u28b2 c.23.12.2 (B:1-143,B:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdktlvmkledetv
sgtcvtrdgaivhpa

SCOP Domain Coordinates for d1u28b2:

Click to download the PDB-style file with coordinates for d1u28b2.
(The format of our PDB-style files is described here.)

Timeline for d1u28b2: