Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Cytohesin 2 [141401] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141402] (2 PDB entries) Uniprot P63034 260-378 |
Domain d1u27a1: 1u27 A:260-378 [119467] complexed with 4ip |
PDB Entry: 1u27 (more details), 2.3 Å
SCOPe Domain Sequences for d1u27a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u27a1 b.55.1.1 (A:260-378) Cytohesin 2 {Mouse (Mus musculus) [TaxId: 10090]} pdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevddprk pncfelyipnnkgqlikackteadgrvvegnhmvyrisaptqeekdewiksiqaavsvd
Timeline for d1u27a1: