Lineage for d1u27a1 (1u27 A:260-378)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803121Protein Cytohesin 2 [141401] (1 species)
  7. 2803122Species Mouse (Mus musculus) [TaxId:10090] [141402] (2 PDB entries)
    Uniprot P63034 260-378
  8. 2803124Domain d1u27a1: 1u27 A:260-378 [119467]
    complexed with 4ip

Details for d1u27a1

PDB Entry: 1u27 (more details), 2.3 Å

PDB Description: Triglycine variant of the ARNO Pleckstrin Homology Domain in complex with Ins(1,3,4,5)P4
PDB Compounds: (A:) Cytohesin 2

SCOPe Domain Sequences for d1u27a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u27a1 b.55.1.1 (A:260-378) Cytohesin 2 {Mouse (Mus musculus) [TaxId: 10090]}
pdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevddprk
pncfelyipnnkgqlikackteadgrvvegnhmvyrisaptqeekdewiksiqaavsvd

SCOPe Domain Coordinates for d1u27a1:

Click to download the PDB-style file with coordinates for d1u27a1.
(The format of our PDB-style files is described here.)

Timeline for d1u27a1: