Lineage for d1u20b_ (1u20 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2577869Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2578152Protein automated matches [190465] (6 species)
    not a true protein
  7. 2578153Species African clawed frog (Xenopus laevis) [TaxId:8355] [187382] (6 PDB entries)
  8. 2578154Domain d1u20b_: 1u20 B: [119464]
    Other proteins in same PDB: d1u20a1
    automated match to d1u20a1
    complexed with gol

Details for d1u20b_

PDB Entry: 1u20 (more details), 2.1 Å

PDB Description: Crystal Structure of Xenopus laevis nudix hydrolase nuclear SnoRNA decapping Protein X29
PDB Compounds: (B:) U8 snoRNA-binding protein X29

SCOPe Domain Sequences for d1u20b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u20b_ d.113.1.1 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt
rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri
eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre
dqiqevlkashr

SCOPe Domain Coordinates for d1u20b_:

Click to download the PDB-style file with coordinates for d1u20b_.
(The format of our PDB-style files is described here.)

Timeline for d1u20b_: