SCOP 1.75: Domain d1u1td1: 1u1t D:6-71

Lineage for d1u1td1 (1u1t D:6-71)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families)

5. Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)
   forms homohexameric ring structures

6. Protein Pleiotropic translational regulator Hfq [74940] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141293] (2 PDB entries)
   Uniprot Q9HUM0 6-71

8. Domain d1u1td1: 1u1t D:6-71 [119460]
   automatically matched to 1U1S A:6-71

Details for d1u1td1

PDB Entry: 1u1t, 1.9 Å

PDB Description: Hfq protein from Pseudomonas aeruginosa. High-salt crystals

PDB Compounds: (D:) Hfq protein

SCOP Domain Sequences for d1u1td1:

Sequence; same for both SEQRES and ATOM records:

>d1u1td1 b.38.1.2 (D:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
rpvrlp

Timeline for d1u1td1:

• d1u1td1 first appeared in SCOP 1.73
  
• d1u1td1 is called d1u1td_ in SCOPe 2.01
  
• d1u1td1 appears in the current release, SCOPe 2.08, called d1u1td_