![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.38: Sm-like fold [50181] (3 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) ![]() |
![]() | Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein) forms homohexameric ring structures |
![]() | Protein Pleiotropic translational regulator Hfq [74940] (3 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [141293] (2 PDB entries) |
![]() | Domain d1u1td1: 1u1t D:6-71 [119460] automatically matched to 1U1S A:6-71 |
PDB Entry: 1u1t (more details), 1.9 Å
SCOP Domain Sequences for d1u1td1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1td1 b.38.1.2 (D:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps rpvrlp
Timeline for d1u1td1: