SCOPe 2.07: Domain d1u1tc_: 1u1t C:

Lineage for d1u1tc_ (1u1t C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
   forms homohexameric ring structures

6. Protein Pleiotropic translational regulator Hfq [74940] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141293] (12 PDB entries)
   Uniprot Q9HUM0 6-71

8. Domain d1u1tc_: 1u1t C: [119459]
   automated match to d1hk9d_

Details for d1u1tc_

PDB Entry: 1u1t, 1.9 Å

PDB Description: Hfq protein from Pseudomonas aeruginosa. High-salt crystals

PDB Compounds: (C:) Hfq protein

SCOPe Domain Sequences for d1u1tc_:

Sequence; same for both SEQRES and ATOM records:

>d1u1tc_ b.38.1.2 (C:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
srpvr

Timeline for d1u1tc_:

• d1u1tc_ first appeared in SCOP 1.73, called d1u1tc1
  
• d1u1tc_ appears in SCOPe 2.06
  
• d1u1tc_ appears in the current release, SCOPe 2.08