Lineage for d1u1tc1 (1u1t C:6-69)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798179Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families) (S)
  5. 798429Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)
    forms homohexameric ring structures
  6. 798430Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 798438Species Pseudomonas aeruginosa [TaxId:287] [141293] (2 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 798447Domain d1u1tc1: 1u1t C:6-69 [119459]
    automatically matched to 1U1S A:6-71

Details for d1u1tc1

PDB Entry: 1u1t (more details), 1.9 Å

PDB Description: Hfq protein from Pseudomonas aeruginosa. High-salt crystals
PDB Compounds: (C:) Hfq protein

SCOP Domain Sequences for d1u1tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1tc1 b.38.1.2 (C:6-69) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
rpvr

SCOP Domain Coordinates for d1u1tc1:

Click to download the PDB-style file with coordinates for d1u1tc1.
(The format of our PDB-style files is described here.)

Timeline for d1u1tc1: