SCOP 1.73: Domain d1u1tc1: 1u1t C:6-69

Lineage for d1u1tc1 (1u1t C:6-69)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.38: Sm-like fold [50181] (3 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families)

5. Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)
   forms homohexameric ring structures

6. Protein Pleiotropic translational regulator Hfq [74940] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141293] (2 PDB entries)

8. Domain d1u1tc1: 1u1t C:6-69 [119459]
   automatically matched to 1U1S A:6-71

Details for d1u1tc1

PDB Entry: 1u1t, 1.9 Å

PDB Description: Hfq protein from Pseudomonas aeruginosa. High-salt crystals

PDB Compounds: (C:) Hfq protein

SCOP Domain Sequences for d1u1tc1:

Sequence; same for both SEQRES and ATOM records:

>d1u1tc1 b.38.1.2 (C:6-69) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
rpvr

Timeline for d1u1tc1:

• d1u1tc1 is new in SCOP 1.73
  
• d1u1tc1 appears in SCOP 1.75
  
• d1u1tc1 appears in the current release, SCOPe 2.08, called d1u1tc_