Lineage for d1u1ta1 (1u1t A:6-71)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666911Fold b.38: Sm-like fold [50181] (3 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 666912Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) (S)
  5. 667162Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)
    forms homohexameric ring structures
  6. 667163Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 667171Species Pseudomonas aeruginosa [TaxId:287] [141293] (2 PDB entries)
  8. 667178Domain d1u1ta1: 1u1t A:6-71 [119457]
    automatically matched to 1U1S A:6-71

Details for d1u1ta1

PDB Entry: 1u1t (more details), 1.9 Å

PDB Description: Hfq protein from Pseudomonas aeruginosa. High-salt crystals
PDB Compounds: (A:) Hfq protein

SCOP Domain Sequences for d1u1ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1ta1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
rpvrlp

SCOP Domain Coordinates for d1u1ta1:

Click to download the PDB-style file with coordinates for d1u1ta1.
(The format of our PDB-style files is described here.)

Timeline for d1u1ta1: