Lineage for d1u1ge1 (1u1g E:4-253)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 702675Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 702676Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 702963Protein Uridine phosphorylase [53176] (2 species)
  7. 702964Species Escherichia coli [TaxId:562] [53177] (13 PDB entries)
    also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP
  8. 702975Domain d1u1ge1: 1u1g E:4-253 [119449]
    automatically matched to d1k3fa_
    complexed with bbb, k

Details for d1u1ge1

PDB Entry: 1u1g (more details), 1.95 Å

PDB Description: structure of e. coli uridine phosphorylase complexed to 5-(m- (benzyloxy)benzyl)barbituric acid (bbba)
PDB Compounds: (E:) Uridine phosphorylase

SCOP Domain Sequences for d1u1ge1:

Sequence, based on SEQRES records: (download)

>d1u1ge1 c.56.2.1 (E:4-253) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d1u1ge1 c.56.2.1 (E:4-253) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqnaetmkqteshavkivve
aarrll

SCOP Domain Coordinates for d1u1ge1:

Click to download the PDB-style file with coordinates for d1u1ge1.
(The format of our PDB-style files is described here.)

Timeline for d1u1ge1: