SCOPe 2.01: Domain d1u1fe_: 1u1f E:

Lineage for d1u1fe_ (1u1f E:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (2 species)

7. Species Escherichia coli [TaxId:562] [53177] (15 PDB entries)

8. Domain d1u1fe_: 1u1f E: [119443]
   automated match to d1k3fa_
   complexed with 183, k, po4

Details for d1u1fe_

PDB Entry: 1u1f, 2.3 Å

PDB Description: structure of e. coli uridine phosphorylase complexed to 5-(m- (benzyloxy)benzyl)acyclouridine (bbau)

PDB Compounds: (E:) Uridine phosphorylase

SCOPe Domain Sequences for d1u1fe_:

Sequence, based on SEQRES records:

>d1u1fe_ c.56.2.1 (E:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll

Sequence, based on observed residues (ATOM records):

>d1u1fe_ c.56.2.1 (E:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqnaetmkqteshavkivv
eaarrll

Timeline for d1u1fe_:

• d1u1fe_ first appeared in SCOP 1.73, called d1u1fe1
  
• d1u1fe_ was called d1u1fe1 in SCOP 1.75
  
• d1u1fe_ appears in SCOPe 2.02
  
• d1u1fe_ appears in the current release, SCOPe 2.08