SCOP 1.75: Domain d1u1fe1: 1u1f E:4-253

Lineage for d1u1fe1 (1u1f E:4-253)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Uridine phosphorylase [53176] (2 species)

7. Species Escherichia coli [TaxId:562] [53177] (13 PDB entries)
   also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP
   also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP

8. Domain d1u1fe1: 1u1f E:4-253 [119443]
   automatically matched to d1k3fa_
   complexed with 183, k, po4

Details for d1u1fe1

PDB Entry: 1u1f, 2.3 Å

PDB Description: structure of e. coli uridine phosphorylase complexed to 5-(m- (benzyloxy)benzyl)acyclouridine (bbau)

PDB Compounds: (E:) Uridine phosphorylase

SCOP Domain Sequences for d1u1fe1:

Sequence, based on SEQRES records:

>d1u1fe1 c.56.2.1 (E:4-253) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records):

>d1u1fe1 c.56.2.1 (E:4-253) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqnaetmkqteshavkivve
aarrll

Timeline for d1u1fe1:

• d1u1fe1 first appeared in SCOP 1.73
  
• d1u1fe1 is called d1u1fe_ in SCOPe 2.01
  
• d1u1fe1 appears in the current release, SCOPe 2.08, called d1u1fe_