Lineage for d1u1ec_ (1u1e C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888268Protein Uridine phosphorylase [53176] (6 species)
  7. 2888269Species Escherichia coli [TaxId:562] [53177] (16 PDB entries)
  8. 2888302Domain d1u1ec_: 1u1e C: [119435]
    Other proteins in same PDB: d1u1ea3
    automated match to d1k3fa_
    complexed with 182, k, po4

Details for d1u1ec_

PDB Entry: 1u1e (more details), 2 Å

PDB Description: structure of e. coli uridine phosphorylase complexed to 5(phenylseleno)acyclouridine (psau)
PDB Compounds: (C:) Uridine phosphorylase

SCOPe Domain Sequences for d1u1ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1ec_ c.56.2.1 (C:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

SCOPe Domain Coordinates for d1u1ec_:

Click to download the PDB-style file with coordinates for d1u1ec_.
(The format of our PDB-style files is described here.)

Timeline for d1u1ec_: