Lineage for d1u1dd1 (1u1d D:4-253)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 837625Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 837626Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 837916Protein Uridine phosphorylase [53176] (2 species)
  7. 837917Species Escherichia coli [TaxId:562] [53177] (13 PDB entries)
    also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP
    also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP
  8. 837949Domain d1u1dd1: 1u1d D:4-253 [119430]
    automatically matched to d1k3fa_
    complexed with 181, k, po4

Details for d1u1dd1

PDB Entry: 1u1d (more details), 2 Å

PDB Description: structure of e. coli uridine phosphorylase complexed to 5- (phenylthio)acyclouridine (ptau)
PDB Compounds: (D:) Uridine phosphorylase

SCOP Domain Sequences for d1u1dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1dd1 c.56.2.1 (D:4-253) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

SCOP Domain Coordinates for d1u1dd1:

Click to download the PDB-style file with coordinates for d1u1dd1.
(The format of our PDB-style files is described here.)

Timeline for d1u1dd1: