Lineage for d1u1da2 (1u1d A:2-253)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2496076Protein Uridine phosphorylase [53176] (6 species)
  7. 2496077Species Escherichia coli [TaxId:562] [53177] (16 PDB entries)
  8. 2496100Domain d1u1da2: 1u1d A:2-253 [119427]
    Other proteins in same PDB: d1u1da3
    automated match to d1k3fa_
    complexed with 181, k, po4

Details for d1u1da2

PDB Entry: 1u1d (more details), 2 Å

PDB Description: structure of e. coli uridine phosphorylase complexed to 5- (phenylthio)acyclouridine (ptau)
PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d1u1da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1da2 c.56.2.1 (A:2-253) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkp
vivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgasl
hfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfk
gsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesha
vkivveaarrll

SCOPe Domain Coordinates for d1u1da2:

Click to download the PDB-style file with coordinates for d1u1da2.
(The format of our PDB-style files is described here.)

Timeline for d1u1da2: