| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
| Protein Uridine phosphorylase [53176] (2 species) |
| Species Escherichia coli [TaxId:562] [53177] (15 PDB entries) |
| Domain d1u1ce_: 1u1c E: [119425] automated match to d1k3fa_ complexed with bau, k, po4 |
PDB Entry: 1u1c (more details), 2.2 Å
SCOPe Domain Sequences for d1u1ce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1ce_ c.56.2.1 (E:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll
Timeline for d1u1ce_: