Lineage for d1u18b_ (1u18 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804587Protein Nitrophorin 1 [50841] (1 species)
  7. 2804588Species Rhodnius prolixus [TaxId:13249] [50842] (6 PDB entries)
  8. 2804592Domain d1u18b_: 1u18 B: [119418]
    automated match to d1np1a_
    complexed with hem, hsm, po4; mutant

Details for d1u18b_

PDB Entry: 1u18 (more details), 1.96 Å

PDB Description: 1.96 A Crystal structure of H60C mutant of nitrophorin complexed with histamine
PDB Compounds: (B:) nitrophorin 1

SCOPe Domain Sequences for d1u18b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u18b_ b.60.1.1 (B:) Nitrophorin 1 {Rhodnius prolixus [TaxId: 13249]}
kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealycy
dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
lltk

SCOPe Domain Coordinates for d1u18b_:

Click to download the PDB-style file with coordinates for d1u18b_.
(The format of our PDB-style files is described here.)

Timeline for d1u18b_: