Lineage for d1u18a_ (1u18 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2414103Protein Nitrophorin 1 [50841] (1 species)
  7. 2414104Species Rhodnius prolixus [TaxId:13249] [50842] (6 PDB entries)
  8. 2414107Domain d1u18a_: 1u18 A: [119417]
    automated match to d1np1a_
    complexed with hem, hsm, po4; mutant

Details for d1u18a_

PDB Entry: 1u18 (more details), 1.96 Å

PDB Description: 1.96 A Crystal structure of H60C mutant of nitrophorin complexed with histamine
PDB Compounds: (A:) nitrophorin 1

SCOPe Domain Sequences for d1u18a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u18a_ b.60.1.1 (A:) Nitrophorin 1 {Rhodnius prolixus [TaxId: 13249]}
kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealycy
dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
lltk

SCOPe Domain Coordinates for d1u18a_:

Click to download the PDB-style file with coordinates for d1u18a_.
(The format of our PDB-style files is described here.)

Timeline for d1u18a_: