Lineage for d1u17a1 (1u17 A:2-185)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805867Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 805868Superfamily b.60.1: Lipocalins [50814] (9 families) (S)
    bind hydrophobic ligands in their interior
  5. 805869Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
    barrel, closed; n=8, S=12, meander
  6. 806014Protein Nitrophorin 1 [50841] (1 species)
  7. 806015Species Rhodnius prolixus [TaxId:13249] [50842] (6 PDB entries)
  8. 806016Domain d1u17a1: 1u17 A:2-185 [119415]
    complexed with hem, imd, po4; mutant

Details for d1u17a1

PDB Entry: 1u17 (more details), 1.7 Å

PDB Description: 1.7 A Crystal structure of H60C mutant of Nitrophorin I. Heme complexed with two molecules imidazole
PDB Compounds: (A:) nitrophorin 1

SCOP Domain Sequences for d1u17a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u17a1 b.60.1.1 (A:2-185) Nitrophorin 1 {Rhodnius prolixus [TaxId: 13249]}
kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealycy
dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
lltk

SCOP Domain Coordinates for d1u17a1:

Click to download the PDB-style file with coordinates for d1u17a1.
(The format of our PDB-style files is described here.)

Timeline for d1u17a1: