Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (9 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins) barrel, closed; n=8, S=12, meander |
Protein Nitrophorin 1 [50841] (1 species) |
Species Rhodnius prolixus [TaxId:13249] [50842] (6 PDB entries) |
Domain d1u17a1: 1u17 A:2-185 [119415] complexed with hem, imd, po4; mutant |
PDB Entry: 1u17 (more details), 1.7 Å
SCOP Domain Sequences for d1u17a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u17a1 b.60.1.1 (A:2-185) Nitrophorin 1 {Rhodnius prolixus [TaxId: 13249]} kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealycy dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks lltk
Timeline for d1u17a1: