Lineage for d1u0za_ (1u0z A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. Protein HSP90 [55876] (3 species)
  7. Species Dog (Canis familiaris) [TaxId:9615] [103225] (33 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. Domain d1u0za_: 1u0z A: [119413]
    Other proteins in same PDB: d1u0zb3
    automated match to d1u2oa_
    complexed with 1pe, pg4, rdc

Details for d1u0za_

PDB Entry: 1u0z (more details), 1.9 Å

PDB Description: n-domain of grp94 lacking the charged domain in complex with radicicol
PDB Compounds: (A:) Endoplasmin

SCOPe Domain Sequences for d1u0za_:

Sequence, based on SEQRES records: (download)

>d1u0za_ d.122.1.1 (A:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
vkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstselig
qfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlke
easdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d1u0za_ d.122.1.1 (A:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
vkikcdkeknllhvtdtgvgmtreelvknlgtigtseflnkmtetseligqfgvgfysaf
lvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldt
iknlvkkysqfinfpiyvwssktvwdwelmn

SCOPe Domain Coordinates for d1u0za_ are not available.

Timeline for d1u0za_:

Domains from other chains:
(mouse over for more information)
d1u0zb2, d1u0zb3