Lineage for d1u0nd_ (1u0n D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2460154Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 2460176Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (2 species)
  7. 2460177Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)
  8. 2460187Domain d1u0nd_: 1u0n D: [119408]
    Other proteins in same PDB: d1u0na_, d1u0nb_, d1u0nc_
    automated match to d1m0za_

Details for d1u0nd_

PDB Entry: 1u0n (more details), 2.95 Å

PDB Description: the ternary von willebrand factor a1-glycoprotein ibalpha-botrocetin complex
PDB Compounds: (D:) Platelet glycoprotein Ib

SCOPe Domain Sequences for d1u0nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0nd_ c.10.2.7 (D:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcp

SCOPe Domain Coordinates for d1u0nd_:

Click to download the PDB-style file with coordinates for d1u0nd_.
(The format of our PDB-style files is described here.)

Timeline for d1u0nd_: