Lineage for d1u0nd1 (1u0n D:1-265)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690278Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 690329Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 690420Family c.10.2.7: Ngr ectodomain-like [75142] (5 proteins)
  6. 690438Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)
  7. 690439Species Human (Homo sapiens) [TaxId:9606] [75144] (9 PDB entries)
  8. 690448Domain d1u0nd1: 1u0n D:1-265 [119408]
    Other proteins in same PDB: d1u0na1, d1u0nb1, d1u0nc1
    automatically matched to d1m0za_
    mutant

Details for d1u0nd1

PDB Entry: 1u0n (more details), 2.95 Å

PDB Description: The ternary von Willebrand Factor A1-glycoprotein Ibalpha-botrocetin complex
PDB Compounds: (D:) Platelet glycoprotein Ib

SCOP Domain Sequences for d1u0nd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0nd1 c.10.2.7 (D:1-265) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcp

SCOP Domain Coordinates for d1u0nd1:

Click to download the PDB-style file with coordinates for d1u0nd1.
(The format of our PDB-style files is described here.)

Timeline for d1u0nd1: