SCOPe 2.08: Domain d1u0nd_: 1u0n D:

Lineage for d1u0nd_ (1u0n D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
   applies to all domains of a family if the common domain is composed of a different number of small repeating units
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)

8. Domain d1u0nd_: 1u0n D: [119408]
   Other proteins in same PDB: d1u0na_, d1u0nb_, d1u0nc_
   automated match to d1m0za_

Details for d1u0nd_

PDB Entry: 1u0n, 2.95 Å

PDB Description: the ternary von willebrand factor a1-glycoprotein ibalpha-botrocetin complex

PDB Compounds: (D:) Platelet glycoprotein Ib

SCOPe Domain Sequences for d1u0nd_:

Sequence; same for both SEQRES and ATOM records:

>d1u0nd_ c.10.2.7 (D:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcp

Timeline for d1u0nd_:

• d1u0nd_ first appeared in SCOP 1.73, called d1u0nd1
  
• d1u0nd_ appears in SCOPe 2.07