Lineage for d1u0nc_ (1u0n C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607635Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 2607648Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88870] (4 PDB entries)
  8. 2607653Domain d1u0nc_: 1u0n C: [119407]
    Other proteins in same PDB: d1u0na_, d1u0nb_, d1u0nd_
    automated match to d1fvub_

Details for d1u0nc_

PDB Entry: 1u0n (more details), 2.95 Å

PDB Description: the ternary von willebrand factor a1-glycoprotein ibalpha-botrocetin complex
PDB Compounds: (C:) Botrocetin

SCOPe Domain Sequences for d1u0nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0nc_ d.169.1.1 (C:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
cefqa

SCOPe Domain Coordinates for d1u0nc_:

Click to download the PDB-style file with coordinates for d1u0nc_.
(The format of our PDB-style files is described here.)

Timeline for d1u0nc_: