Lineage for d1u0nc1 (1u0n C:2001-2125)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738201Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 738214Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88870] (4 PDB entries)
  8. 738219Domain d1u0nc1: 1u0n C:2001-2125 [119407]
    Other proteins in same PDB: d1u0na1, d1u0nb1, d1u0nd1
    automatically matched to d1fvub_
    mutant

Details for d1u0nc1

PDB Entry: 1u0n (more details), 2.95 Å

PDB Description: The ternary von Willebrand Factor A1-glycoprotein Ibalpha-botrocetin complex
PDB Compounds: (C:) Botrocetin

SCOP Domain Sequences for d1u0nc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0nc1 d.169.1.1 (C:2001-2125) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
cefqa

SCOP Domain Coordinates for d1u0nc1:

Click to download the PDB-style file with coordinates for d1u0nc1.
(The format of our PDB-style files is described here.)

Timeline for d1u0nc1: