Lineage for d1u0nb1 (1u0n B:1001-1133)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738161Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 738178Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88864] (4 PDB entries)
  8. 738183Domain d1u0nb1: 1u0n B:1001-1133 [119406]
    Other proteins in same PDB: d1u0na1, d1u0nc1, d1u0nd1
    automatically matched to d1fvua_
    mutant

Details for d1u0nb1

PDB Entry: 1u0n (more details), 2.95 Å

PDB Description: The ternary von Willebrand Factor A1-glycoprotein Ibalpha-botrocetin complex
PDB Compounds: (B:) Botrocetin

SCOP Domain Sequences for d1u0nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0nb1 d.169.1.1 (B:1001-1133) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

SCOP Domain Coordinates for d1u0nb1:

Click to download the PDB-style file with coordinates for d1u0nb1.
(The format of our PDB-style files is described here.)

Timeline for d1u0nb1: