SCOPe 2.08: Domain d1u0nb_: 1u0n B:

Lineage for d1u0nb_ (1u0n B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin alpha chain [88861] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88864] (4 PDB entries)

8. Domain d1u0nb_: 1u0n B: [119406]
   Other proteins in same PDB: d1u0na_, d1u0nc_, d1u0nd_
   automated match to d1fvua_

Details for d1u0nb_

PDB Entry: 1u0n, 2.95 Å

PDB Description: the ternary von willebrand factor a1-glycoprotein ibalpha-botrocetin complex

PDB Compounds: (B:) Botrocetin

SCOPe Domain Sequences for d1u0nb_:

Sequence; same for both SEQRES and ATOM records:

>d1u0nb_ d.169.1.1 (B:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

Timeline for d1u0nb_:

• d1u0nb_ first appeared in SCOP 1.73, called d1u0nb1
  
• d1u0nb_ appears in SCOPe 2.07