![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (5 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins) |
![]() | Protein von Willebrand factor A1 domain, vWA1 [53306] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53307] (9 PDB entries) |
![]() | Domain d1u0na1: 1u0n A:498-705 [119405] Other proteins in same PDB: d1u0nb1, d1u0nc1, d1u0nd1 automatically matched to d1auq__ mutant |
PDB Entry: 1u0n (more details), 2.95 Å
SCOP Domain Sequences for d1u0na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0na1 c.62.1.1 (A:498-705) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} disepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavve yhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasri alllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvl ssvdeleqqrdeivsylcdlapeapppt
Timeline for d1u0na1: