Lineage for d1u0na_ (1u0n A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. Protein automated matches [190060] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries)
  8. Domain d1u0na_: 1u0n A: [119405]
    Other proteins in same PDB: d1u0nb_, d1u0nc_, d1u0nd_
    automated match to d1auq__

Details for d1u0na_

PDB Entry: 1u0n (more details), 2.95 Å

PDB Description: The ternary von Willebrand Factor A1-glycoprotein Ibalpha-botrocetin complex
PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d1u0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0na_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
disepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavve
yhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasri
alllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvl
ssvdeleqqrdeivsylcdlapeapppt

SCOPe Domain Coordinates for d1u0na_ are not available.

Timeline for d1u0na_:

Domains from other chains:
(mouse over for more information)
d1u0nb_, d1u0nc_, d1u0nd_