SCOPe 2.02: Domain d1tzgl2: 1tzg L:108-213

Lineage for d1tzgl2 (1tzg L:108-213)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (134 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1tzgl2: 1tzg L:108-213 [119401]
   Other proteins in same PDB: d1tzgh1, d1tzgh2, d1tzgi1, d1tzgi2, d1tzgl1, d1tzgm1
   automatically matched to d1rhha2
   complexed with gol

Details for d1tzgl2

PDB Entry: 1tzg, 2.2 Å

PDB Description: Crystal structure of HIV-1 neutralizing human Fab 4E10 in complex with a 13-residue peptide containing the 4E10 epitope on gp41

PDB Compounds: (L:) Fab 4E10

SCOPe Domain Sequences for d1tzgl2:

Sequence; same for both SEQRES and ATOM records:

>d1tzgl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d1tzgl2:

• d1tzgl2 first appeared in SCOP 1.73
  
• d1tzgl2 appears in SCOPe 2.01
  
• d1tzgl2 appears in SCOPe 2.03
  
• d1tzgl2 appears in the current release, SCOPe 2.07