Lineage for d1tzgl2 (1tzg L:107-213)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (12 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (557 PDB entries)
  8. 2024596Domain d1tzgl2: 1tzg L:107-213 [119401]
    Other proteins in same PDB: d1tzgh1, d1tzgh2, d1tzgi1, d1tzgi2, d1tzgl1, d1tzgm1
    automated match to d4hcrl2
    complexed with gol

Details for d1tzgl2

PDB Entry: 1tzg (more details), 2.2 Å

PDB Description: Crystal structure of HIV-1 neutralizing human Fab 4E10 in complex with a 13-residue peptide containing the 4E10 epitope on gp41
PDB Compounds: (L:) Fab 4E10

SCOPe Domain Sequences for d1tzgl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzgl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d1tzgl2:

Click to download the PDB-style file with coordinates for d1tzgl2.
(The format of our PDB-style files is described here.)

Timeline for d1tzgl2: