Lineage for d1tzgl1 (1tzg L:1-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519548Domain d1tzgl1: 1tzg L:1-106 [119400]
    Other proteins in same PDB: d1tzgh1, d1tzgh2, d1tzgi1, d1tzgi2, d1tzgl2, d1tzgm2
    automated match to d4fnll1
    complexed with gol

Details for d1tzgl1

PDB Entry: 1tzg (more details), 2.2 Å

PDB Description: Crystal structure of HIV-1 neutralizing human Fab 4E10 in complex with a 13-residue peptide containing the 4E10 epitope on gp41
PDB Compounds: (L:) Fab 4E10

SCOPe Domain Sequences for d1tzgl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzgl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

SCOPe Domain Coordinates for d1tzgl1:

Click to download the PDB-style file with coordinates for d1tzgl1.
(The format of our PDB-style files is described here.)

Timeline for d1tzgl1: