SCOPe 2.08: Domain d1tzgh2: 1tzg H:114-232

Lineage for d1tzgh2 (1tzg H:114-232)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1tzgh2: 1tzg H:114-232 [119397]
   Other proteins in same PDB: d1tzgh1, d1tzgi1, d1tzgl1, d1tzgl2, d1tzgm1, d1tzgm2
   automatically matched to d1ngzb2
   complexed with gol

Details for d1tzgh2

PDB Entry: 1tzg, 2.2 Å

PDB Description: Crystal structure of HIV-1 neutralizing human Fab 4E10 in complex with a 13-residue peptide containing the 4E10 epitope on gp41

PDB Compounds: (H:) Fab 4E10

SCOPe Domain Sequences for d1tzgh2:

Sequence; same for both SEQRES and ATOM records:

>d1tzgh2 b.1.1.2 (H:114-232) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdk

Timeline for d1tzgh2:

• d1tzgh2 first appeared in SCOP 1.73
  
• d1tzgh2 appears in SCOPe 2.07