Lineage for d1tz7b1 (1tz7 B:1-485)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815286Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 815303Protein Amylomaltase MalQ [51478] (3 species)
    4-alpha-glucanotransferase; single-domain amylase with several insertions in the common fold
  7. 815304Species Aquifex aeolicus [TaxId:63363] [141770] (1 PDB entry)
    Uniprot O66937 1-485
  8. 815306Domain d1tz7b1: 1tz7 B:1-485 [119395]
    automatically matched to 1TZ7 A:1-485
    complexed with mpd

Details for d1tz7b1

PDB Entry: 1tz7 (more details), 2.15 Å

PDB Description: Aquifex aeolicus amylomaltase
PDB Compounds: (B:) 4-alpha-glucanotransferase

SCOP Domain Sequences for d1tz7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tz7b1 c.1.8.1 (B:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]}
mrlagillhvtslpspygigdlgkeayrfldflkecgfslwqvlplnptsleagnspyss
nslfagnyvlidpeelleedlikerdlkrfplgealyevvyeykkellekafknfrrfel
ledflkehsywlrdyalymaikeeegkewyewdeelkrrekealkrvlnklkgrfyfhvf
vqfvffkqweklrryarergisivgdlpmypsyssadvwtnpelfkldgdlkplfvagvp
pdffsktgqlwgnpvynweehekegfrwwirrvlhnlklfdflrldhfrgfeaywevpyg
eetavngrwvkapgktlfkkllsyfpknpfiaedlgfitdevrylretfkipgsrviefa
fydkesehlphnveennvyytsthdlppirgwfenlgeesrkrlfeylgreikeekvnee
lirlvlisrakfaiiqmqdllnlgnearmnypgrpfgnwrwrikedytqkkefikkllgi
ygrev

SCOP Domain Coordinates for d1tz7b1:

Click to download the PDB-style file with coordinates for d1tz7b1.
(The format of our PDB-style files is described here.)

Timeline for d1tz7b1: