Lineage for d1tz7b2 (1tz7 B:1-485)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2829836Protein Amylomaltase MalQ [51478] (3 species)
    4-alpha-glucanotransferase; single-domain amylase with several insertions in the common fold
  7. 2829837Species Aquifex aeolicus [TaxId:63363] [141770] (1 PDB entry)
    Uniprot O66937 1-485
  8. 2829839Domain d1tz7b2: 1tz7 B:1-485 [119395]
    Other proteins in same PDB: d1tz7a2, d1tz7b3
    automated match to d1tz7a1
    complexed with mpd

    has additional insertions and/or extensions that are not grouped together

Details for d1tz7b2

PDB Entry: 1tz7 (more details), 2.15 Å

PDB Description: Aquifex aeolicus amylomaltase
PDB Compounds: (B:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1tz7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tz7b2 c.1.8.1 (B:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]}
mrlagillhvtslpspygigdlgkeayrfldflkecgfslwqvlplnptsleagnspyss
nslfagnyvlidpeelleedlikerdlkrfplgealyevvyeykkellekafknfrrfel
ledflkehsywlrdyalymaikeeegkewyewdeelkrrekealkrvlnklkgrfyfhvf
vqfvffkqweklrryarergisivgdlpmypsyssadvwtnpelfkldgdlkplfvagvp
pdffsktgqlwgnpvynweehekegfrwwirrvlhnlklfdflrldhfrgfeaywevpyg
eetavngrwvkapgktlfkkllsyfpknpfiaedlgfitdevrylretfkipgsrviefa
fydkesehlphnveennvyytsthdlppirgwfenlgeesrkrlfeylgreikeekvnee
lirlvlisrakfaiiqmqdllnlgnearmnypgrpfgnwrwrikedytqkkefikkllgi
ygrev

SCOPe Domain Coordinates for d1tz7b2:

Click to download the PDB-style file with coordinates for d1tz7b2.
(The format of our PDB-style files is described here.)

Timeline for d1tz7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tz7b3