Lineage for d1tz5a1 (1tz5 A:1-36)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 899306Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 899307Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 899308Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 899360Protein Neuropeptide Y [58289] (2 species)
  7. 899361Species Human (Homo sapiens) [TaxId:9606] [58290] (2 PDB entries)
  8. 899363Domain d1tz5a1: 1tz5 A:1-36 [119393]
    Chimera of pancreatic hormone and neuropeptide Y

Details for d1tz5a1

PDB Entry: 1tz5 (more details)

PDB Description: [pnpy19-23]-hpp bound to dpc micelles
PDB Compounds: (A:) Chimera of Pancreatic hormone and Neuropeptide Y

SCOP Domain Sequences for d1tz5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tz5a1 j.6.1.1 (A:1-36) Neuropeptide Y {Human (Homo sapiens) [TaxId: 9606]}
aplepvypgdnatpeqmaryysalrryinmltrpry

SCOP Domain Coordinates for d1tz5a1:

Click to download the PDB-style file with coordinates for d1tz5a1.
(The format of our PDB-style files is described here.)

Timeline for d1tz5a1: