SCOP 1.73: Domain d1tz1a1: 1tz1 A:780-854

Lineage for d1tz1a1 (1tz1 A:780-854)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (10 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Cell division control protein 24, CDC24, C-terminal domain [89834] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89835] (3 PDB entries)

8. Domain d1tz1a1: 1tz1 A:780-854 [119391]
   automatically matched to d1pqsa_

Details for d1tz1a1

PDB Entry: 1tz1

PDB Description: solution structure of the pb1 domain of cdc24p (short form)

PDB Compounds: (A:) Cell division control protein 24

SCOP Domain Sequences for d1tz1a1:

Sequence; same for both SEQRES and ATOM records:

>d1tz1a1 d.15.2.2 (A:780-854) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iftllvekvwnfddlimainskisnthnnnispitkikyqdedgdfvvlgsdedwnvake
mlaennekflnirly

Timeline for d1tz1a1:

• d1tz1a1 is new in SCOP 1.73
  
• d1tz1a1 appears in SCOP 1.75
  
• d1tz1a1 appears in the current release, SCOPe 2.08, called d1tz1a2