Lineage for d1tz1a2 (1tz1 A:780-854)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933606Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2933622Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2933627Protein Cell division control protein 24, CDC24, C-terminal domain [89834] (1 species)
  7. 2933628Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89835] (3 PDB entries)
  8. 2933631Domain d1tz1a2: 1tz1 A:780-854 [119391]
    Other proteins in same PDB: d1tz1a3
    automated match to d1pqsa_

Details for d1tz1a2

PDB Entry: 1tz1 (more details)

PDB Description: solution structure of the pb1 domain of cdc24p (short form)
PDB Compounds: (A:) Cell division control protein 24

SCOPe Domain Sequences for d1tz1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tz1a2 d.15.2.2 (A:780-854) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iftllvekvwnfddlimainskisnthnnnispitkikyqdedgdfvvlgsdedwnvake
mlaennekflnirly

SCOPe Domain Coordinates for d1tz1a2:

Click to download the PDB-style file with coordinates for d1tz1a2.
(The format of our PDB-style files is described here.)

Timeline for d1tz1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tz1a3