![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) ![]() contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
![]() | Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
![]() | Protein Cell division control protein 24, CDC24, C-terminal domain [89834] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89835] (3 PDB entries) |
![]() | Domain d1tz1a2: 1tz1 A:780-854 [119391] Other proteins in same PDB: d1tz1a3 automated match to d1pqsa_ |
PDB Entry: 1tz1 (more details)
SCOPe Domain Sequences for d1tz1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tz1a2 d.15.2.2 (A:780-854) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} iftllvekvwnfddlimainskisnthnnnispitkikyqdedgdfvvlgsdedwnvake mlaennekflnirly
Timeline for d1tz1a2: