Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
Protein Cellulosomal scaffoldin ScaA [141076] (1 species) |
Species Bacteroides cellulosolvens [TaxId:35825] [141077] (1 PDB entry) Uniprot Q9FDJ9 2073-2242 |
Domain d1tyja1: 1tyj A:2-171 [119390] complexed with edo, moh |
PDB Entry: 1tyj (more details), 1.6 Å
SCOPe Domain Sequences for d1tyja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyja1 b.2.2.2 (A:2-171) Cellulosomal scaffoldin ScaA {Bacteroides cellulosolvens [TaxId: 35825]} gsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytdstm pdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkvike ipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypk
Timeline for d1tyja1: