Lineage for d1tyja1 (1tyj A:2-171)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771715Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 1771729Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 1771749Protein Cellulosomal scaffoldin ScaA [141076] (1 species)
  7. 1771750Species Bacteroides cellulosolvens [TaxId:35825] [141077] (1 PDB entry)
    Uniprot Q9FDJ9 2073-2242
  8. 1771751Domain d1tyja1: 1tyj A:2-171 [119390]
    complexed with edo, moh

Details for d1tyja1

PDB Entry: 1tyj (more details), 1.6 Å

PDB Description: Crystal Structure Analysis of type II Cohesin A11 from Bacteroides cellulosolvens
PDB Compounds: (A:) cellulosomal scaffoldin

SCOPe Domain Sequences for d1tyja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyja1 b.2.2.2 (A:2-171) Cellulosomal scaffoldin ScaA {Bacteroides cellulosolvens [TaxId: 35825]}
gsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytdstm
pdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkvike
ipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypk

SCOPe Domain Coordinates for d1tyja1:

Click to download the PDB-style file with coordinates for d1tyja1.
(The format of our PDB-style files is described here.)

Timeline for d1tyja1: