SCOP 1.73: Domain d1tyja1: 1tyj A:2-171

Lineage for d1tyja1 (1tyj A:2-171)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (6 proteins)
   Pfam PF00963

6. Protein Cellulosomal scaffoldin ScaA [141076] (1 species)

7. Species Bacteroides cellulosolvens [TaxId:35825] [141077] (1 PDB entry)

8. Domain d1tyja1: 1tyj A:2-171 [119390]
   complexed with edo, moh

Details for d1tyja1

PDB Entry: 1tyj, 1.6 Å

PDB Description: Crystal Structure Analysis of type II Cohesin A11 from Bacteroides cellulosolvens

PDB Compounds: (A:) cellulosomal scaffoldin

SCOP Domain Sequences for d1tyja1:

Sequence; same for both SEQRES and ATOM records:

>d1tyja1 b.2.2.2 (A:2-171) Cellulosomal scaffoldin ScaA {Bacteroides cellulosolvens [TaxId: 35825]}
gsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytdstm
pdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkvike
ipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypk

Timeline for d1tyja1:

• d1tyja1 is new in SCOP 1.73
  
• d1tyja1 appears in SCOP 1.75
  
• d1tyja1 appears in the current release, SCOPe 2.08